Scaffold Ga0211732_1299215

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211732_1299215

Scaffold Ga0211732_1299215

Overview

Basic Information
Taxon OID	3300020141 Open in IMG/M
Scaffold ID	Ga0211732_1299215 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	SciLifeLab
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6065
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (7.69%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location Name	Lake Erken, Sweden
Coordinates	Lat. (^o)	59.83763399	Long. (^o)	18.6203826	Alt. (m)		Depth (m)	10 to 20
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075716	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211732_129921512	F075716	N/A	MTTFNKFKFEHTDSNSKLTLEVGVDGCQEIVDEFISFMRGAGFMDASIYSAMENAVEEYSGYQAHLEKAIELGMRVPLGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.