NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194112_10661644

Scaffold Ga0194112_10661644


Overview

Basic Information
Taxon OID3300020109 Open in IMG/M
Scaffold IDGa0194112_10661644 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)703
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.1786Long. (o)29.658Alt. (m)Depth (m)400
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000744Metagenome / Metatranscriptome909Y
F002243Metagenome / Metatranscriptome578Y
F048268Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0194112_106616441F048268N/ASFTTMKLSDSSITKIADALKPAVINYIYEDPQFAEYMHDAVIEGIQSVMGDMDEDLLFEIGMLVFDRIELK
Ga0194112_106616442F000744GGAMMTETTLKLNIHEIGVLLSALQLLDLSEEKIIAHEYGSVPALYNKLYTLYEQMDSSETGLRNDLVPSF
Ga0194112_106616443F002243GGAGMPDFPTLQSKDGTMLVGFYPLQDSYGDISTEWCVQILSWKGVDQISKKYLNRVEKSLAIRERLAYDYVVTGDNQDLPQTGNPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.