Scaffold Ga0194112_10075475

Overview

Basic Information

• Taxon OID: 3300020109
• Scaffold ID: Ga0194112_10075475
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3158
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -6.1786
  • Long. (^o): 29.658
  • Depth (m): 400

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054795	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194112_100754752	F054795	N/A	MRFTEFKQPTLRAYRIVVLLSDNGSAETLIYSDTPENAWLIASKQYGSKNIVSVNDPNKPTANKPTDKPSAIQFWTDRFRKFARLAKPEPKPLEFADQVDDYLERQDARSLARVKAEKAKRQLNSLRR