Scaffold Ga0194113_10283411

Overview

Basic Information

• Taxon OID: 3300020074
• Scaffold ID: Ga0194113_10283411
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1267
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -6.1786
  • Long. (^o): 29.658
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034078	Metagenome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194113_102834111	F034078	GGAGG	MNDWKNYINQNGDFELPNFLYRTVNDLMKQSLDMGTLLSEDQYKLRAYKEQTKKLFKNKWFDLAEALEHFGIIEKCVCSPINNSGKEIYCDVCKGARYVINSALSPNEMREISMFVGAAQGIQVQEKLQKGLMKLLEEM