Scaffold Ga0180113_1286939

Overview

Basic Information

• Taxon OID: 3300020065
• Scaffold ID: Ga0180113_1286939
• Source Dataset Name: Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 783
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9231
  • Long. (^o): -106.9513
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009163	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180113_12869392	F009163	N/A	FQQDKKVLMDTFARVEPGKDSVYGRKMVVEHPDNKGRTMGAFFFHKGKLIAMEGTVLPANGDYESPDPARFIDSIVFVLSRTGEGAIELQAPKLE