Scaffold Ga0193724_1113165

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193724_1113165

Scaffold Ga0193724_1113165

Overview

Basic Information
Taxon OID	3300020062 Open in IMG/M
Scaffold ID	Ga0193724_1113165 Open in IMG/M
Source Dataset Name	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	541
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9866	Long. (^o)	-107.0007	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014560	Metagenome / Metatranscriptome	262	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193724_11131651	F014560	N/A	LQVRAGAARFMLSGASSAAVDGSAAVPSARLLSGTMVFSTANGKAFLLHASTADIRPQTDQPTVAQVTYISDKELQVRSTRGSLTITVDDETQVVPEAMAYRVILDPSSYYAAENAQGPRGVGTRQGGPPLKAGRSHFLLIAIILTGIATGVALYEALQSSDAPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.