Scaffold Ga0207193_1345482

Overview

Basic Information

• Taxon OID: 3300020048
• Scaffold ID: Ga0207193_1345482
• Source Dataset Name: Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1022
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota

Source Dataset Sampling Location

• Location Name: Lake Manganika, Minnesota, USA
• Coordinates
  • Lat. (^o): 47.489552
  • Long. (^o): -92.573009

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009745	Metagenome / Metatranscriptome	313	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207193_13454821	F009745	N/A	TLPKAVVLCDSARPPGSLDEGAGNYDCSVRITLFSNADDTTLADHRTRCAALVGNMRDIASIKAAFVSGGDATCYDVSIISEDEGIDERSWATSFAFSVWTCLAP