Scaffold Ga0193755_1027025

Overview

Basic Information

• Taxon OID: 3300020004
• Scaffold ID: Ga0193755_1027025
• Source Dataset Name: Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1899
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9763
  • Long. (^o): -107.0041
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065185	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193755_10270252	F065185	AGGA	MKITFDDKSFIEARKSDNPGKIVITISALDHADPLKKITNAVEISTEEFKKLISDV