Scaffold Ga0193710_1032878

Overview

Basic Information

• Taxon OID: 3300019998
• Scaffold ID: Ga0193710_1032878
• Source Dataset Name: Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9825
  • Long. (^o): -107.0101
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032181	Metagenome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193710_10328782	F032181	AGGAG	MVSNVLETDQEELMKLLKSFKTKYAGDPEWEQIRAGFPKSWPI