Scaffold Ga0206388_1067825

Overview

Basic Information

• Taxon OID: 3300019861
• Scaffold ID: Ga0206388_1067825
• Source Dataset Name: Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11699
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (82.35%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 36.0
  • Long. (^o): -97.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059711	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206388_10678253	F059711	GGAG	MRERIFHTSMNLLLDPDTYQRIKMIARLKKMPMSKFIREGINLRLAQYDKENNSITGGKDQERTDNQ