Basic Information | |
---|---|
Taxon OID | 3300019861 Open in IMG/M |
Scaffold ID | Ga0206388_1015953 Open in IMG/M |
Source Dataset Name | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5743 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -97.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069913 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206388_10159532 | F069913 | N/A | LAKRKIAMTLDEYSALEEEFHSSHTDIKSFLKKRGVSYTTYYYWKCKSRDLKEQSGGQFLPIDVQQGGFIKPARRSKNLKQPLITQGEIEIELRTPAGAEIRIRGYMDSIMVSTIIAVSGGRRNV |
⦗Top⦘ |