Scaffold Ga0193960_1129584

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193960_1129584

Scaffold Ga0193960_1129584

Overview

Basic Information
Taxon OID	3300019768 Open in IMG/M
Scaffold ID	Ga0193960_1129584 Open in IMG/M
Source Dataset Name	Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_3_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	648
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	USA: Delaware
Coordinates	Lat. (^o)	38.7906	Long. (^o)	-75.1644	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034579	Metagenome / Metatranscriptome	174	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193960_11295841	F034579	N/A	HGIVRRAYTKTFNVDLLTEFRMEQINMNPKVELPPVPELGDLDVSAVKRQQYLLS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.