Scaffold Ga0194024_1022743

Overview

Basic Information

• Taxon OID: 3300019765
• Scaffold ID: Ga0194024_1022743
• Source Dataset Name: Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1343
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1638
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034554	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194024_10227432	F034554	N/A	TGDTDIENSGFKTVAELRDSTLTSPTSTHWKTRLALDEKESLESIMEQLQYEGCFFFEFSPQAQQTAISGVSGLRYFTIEDNVTANVDLSQNDISGYELGITSAQDLETRLLVNYKKHPAENEYLKQDTFTASTHTTIFGDADIQKQEINLDLVYDAVEDVVGSRNSSWINFRKSLFGDYKTTVNATLVNPEKYGMLQVGDYIDFGEITFEELGSPFNEISDTFDSFVAMPTRLFKDAWSGKKFIITNLKRQVGKVSVQCREV