NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193961_1151314

Scaffold Ga0193961_1151314


Overview

Basic Information
Taxon OID3300019759 Open in IMG/M
Scaffold IDGa0193961_1151314 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_4_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)538
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020094Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0193961_11513142F020094N/AFTNLYNLKVKMNYFMSYMSLSFFNHQKLISYVININLSSTNTLINLNDIKGNPKFFYSAGMFNLQKNQKTRQPKAIITILRALLSKSKIFKTKPVAVHFNNLFFNHQSYIFKKLKQKIFIKLVTSYKYGSHNGCRLKKKKRIKVRTRTRKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.