Scaffold Ga0194020_1036179

Overview

Basic Information

• Taxon OID: 3300019741
• Scaffold ID: Ga0194020_1036179
• Source Dataset Name: Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 644
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1638
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026407	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194020_10361791	F026407	GGAG	MHNITNSEIKQSNLINDNAKQWVIDNIDYLNKPMQFFGSSTKLEKGSDKYDSYVMYLQPADKVSVKTLCSFADKAGCKEPCLIDSGQLGMSTGQNAATKRTILMLLRPDYFKSKILA