Scaffold Ga0194011_1002965

Overview

Basic Information

• Taxon OID: 3300019721
• Scaffold ID: Ga0194011_1002965
• Source Dataset Name: Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1288
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1638
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028939	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194011_10029653	F028939	N/A	MKTYKIKIQKYKLFKYNLLKLQTYSKKATFEISNFLYGLLEQIEAYLKQVLKIIFEYHVNHFNILFIGFPLVSKIKQVKL