Basic Information | |
---|---|
Taxon OID | 3300019706 Open in IMG/M |
Scaffold ID | Ga0193995_1054982 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_1-2_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 514 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Delaware | |||||||
Coordinates | Lat. (o) | 38.7906 | Long. (o) | -75.1638 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070127 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193995_10549821 | F070127 | AGG | MKELNFSIAINLSLTLEEDKARINIKNVDLIPAVVSLPKRLNSWNRPASSKAAKKTVHDIILQTAKKYVIDTGQNKFTGAKLFNLSLLDHPGLKRNTFAAQVIAAAPTHPSHRHYPNQKDYFIYLGKGKYKLNQKYLDINEDQMMLPSD |
⦗Top⦘ |