Scaffold Ga0187892_10032497

Overview

Basic Information

• Taxon OID: 3300019458
• Scaffold ID: Ga0187892_10032497
• Source Dataset Name: Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4178
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: USA: the Island of Hawaii
• Coordinates
  • Lat. (^o): 19.0643
  • Long. (^o): -155.8008

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043336	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187892_100324977	F043336	AGG	VGAVIGVWIVRVTLNATFYTPIVGRQFEQMSSAHPGMFRTVIPAYIVTNLIFALVFTFLFVKVGAALGGAIKAGVTLGVIVGLLSPVLGNLYQYYSVTYLPAGLAFTDSIFHVIAHGLEGAIAGVIYKT