NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187901_10775315

Scaffold Ga0187901_10775315


Overview

Basic Information
Taxon OID3300019378 Open in IMG/M
Scaffold IDGa0187901_10775315 Open in IMG/M
Source Dataset NameGoat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)722
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.4148Long. (o)-119.8405Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070723Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0187901_107753152F070723AGGAGGMNNLSGTAKKLDKIFEIVHIVLGALAIACVVGVALIAIAYILKWDPEMIGTNYENFDIGFLELTVAERYAPDKWLILLQAAITLAASCRLFYDGRRGVGYIREILHPMKEEKPFDAIVSTNLKKLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.