Scaffold Ga0187800_1110726

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187800_1110726

Scaffold Ga0187800_1110726

Overview

Basic Information
Taxon OID	3300019278 Open in IMG/M
Scaffold ID	Ga0187800_1110726 Open in IMG/M
Source Dataset Name	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	716
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Colombia: Department of Meta
Coordinates	Lat. (^o)	4.2396	Long. (^o)	-73.2024	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043802	Metagenome / Metatranscriptome	155	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0187800_11107261	F043802	N/A	ANIQFAGINDTWGGEDYGIPSGTYQPHVFVGGYIENDPVEWVSVTLSGNPTSVSDHVYRGAGFNVTVYSIDWERPRVSRPWVWGNPSGYQYANDVIVGGSGSGSNVAPYPYHQNPGLTNAQVSEGCGMVGSWPNGLTQQPGLPRETQSSTSSQSGCLVGQEIDLGFYQNGTLISAAGDELYDEVVSGPSAIVTTCLFQNFTTTVVQMCGGGWDAQLRLANGTYTGTCQSSPGVTGQCG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.