Scaffold Ga0187794_1380714

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187794_1380714

Scaffold Ga0187794_1380714

Overview

Basic Information
Taxon OID	3300019273 Open in IMG/M
Scaffold ID	Ga0187794_1380714 Open in IMG/M
Source Dataset Name	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	504
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Colombia: Department of Meta
Coordinates	Lat. (^o)	4.0627	Long. (^o)	-73.195	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039932	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187794_13807141	F039932	N/A	LVEQDVQAGLKVAAKNLQAGKQAMVERNHRRVGLGISLVAIALAVLGLRLYIKQLES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.