Scaffold Ga0187796_1125102

Overview

Basic Information

• Taxon OID: 3300019264
• Scaffold ID: Ga0187796_1125102
• Source Dataset Name: Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Colombia: Department of Meta
• Coordinates
  • Lat. (^o): 4.0627
  • Long. (^o): -73.195
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080778	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187796_11251021	F080778	N/A	PMETDQTTRQRCEQLETAWAILNDATVELAGRIVTLPPDIYVSLRGAKDLISLCKSHKTVTDLTPAEIDSHEGFCVACCGSDIVGRIKCELRSVEDLLILKAMNEVGSEFALRLQEKTMKAWQAMKPLTVTTR