Scaffold Ga0172286_1421825

Overview

Basic Information

• Taxon OID: 3300019252
• Scaffold ID: Ga0172286_1421825
• Source Dataset Name: Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 545
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3778
  • Long. (^o): -82.5111
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092121	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0172286_14218251	F092121	GAGG	MPKHFYTLLIIPHKKKDSVKKFLATPRHFQLTAVFAVIFFCFFGYCAVDYLTLKLKQMELDNLRELTSTQQEQIDTLHEKISFFDRKLAELKQVDEKIRNMASELTGKSRKLSRKEDPKAREQVLGIGGPMPADEAG