Scaffold Ga0180111_1274318

Overview

Basic Information

• Taxon OID: 3300019244
• Scaffold ID: Ga0180111_1274318
• Source Dataset Name: Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 843
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9228
  • Long. (^o): -106.9508
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013460	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180111_12743182	F013460	GGA	MDQPQEMAFAKTVHCLEVFHAVQTDSRTSGWYWGDVRGKAAVGAATDALLRRDLICSRVGPPPFAITAKGEAFLKTHEHAWEAFLAKTDQPTTIEHFSRALTEIPEVLQAPSV