NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180030_1196866

Scaffold Ga0180030_1196866


Overview

Basic Information
Taxon OID3300019239 Open in IMG/M
Scaffold IDGa0180030_1196866 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)595
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064746Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0180030_11968661F064746N/AVCGCLDTAAEQKSVMIDGYTFTASLNDKWVNSSGDVSKYKPANLEDIQFGIPDGAYDWSGAENYNAFLYRSGEPSGSMTKYGWANIFVLKPDDDLSDSSSIDISKHAAYMIINPKDHRNAVIGGDLTEKEIEYNGRQAYYIEVEGELITLENYHTFINDNSLGAVAFFLDDNTVALIDAFTTNDFGMSAWDVIDSITV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.