Scaffold Ga0180030_1164455

Overview

Basic Information

• Taxon OID: 3300019239
• Scaffold ID: Ga0180030_1164455
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 927
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin028 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051165	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180030_11644552	F051165	N/A	MTTSFQKALAIMASVASVLAGVVTIASYLSGEDAALPPSSATAPSESRPIIIQARAVFVDDDKVYILDYDNNLIEWNESLDVEVL