Scaffold Ga0180028_1224144

Overview

Basic Information

• Taxon OID: 3300019237
• Scaffold ID: Ga0180028_1224144
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101228	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180028_12241442	F101228	N/A	YASGSPIQAAFGILLLICMYLGILWVDRLPRDDRLFWKRLVGITVILLAITVAITYNPVSALTITGEPAGDQIHWEITDGEPPYTVFVNGVEIVSGYPGTVFTTDSEPGRQYTAVVMDNQTVADATVTGEYYTYPLWVWLLFAALIACLIISIWLPYAAFGAAIAGGFLLLLIAPNPDYAPYLRIFAGAAFIVGLAGIAGRLQ