Scaffold Ga0180028_1162359

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180028_1162359

Scaffold Ga0180028_1162359

Overview

Basic Information
Taxon OID	3300019237 Open in IMG/M
Scaffold ID	Ga0180028_1162359 Open in IMG/M
Source Dataset Name	Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	651
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Washington
Coordinates	Lat. (^o)	47.6525	Long. (^o)	-122.3049	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048390	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180028_11623591	F048390	N/A	RTLQHRITKQGRDFYQLSIPPQVAEALNLKDGGPVTIYVQPVKRGEVQIVLAAADSEV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.