Scaffold Ga0179944_1130894

Overview

Basic Information

• Taxon OID: 3300019236
• Scaffold ID: Ga0179944_1130894
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 822
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 41.84
  • Long. (^o): -87.68
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047387	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0179944_11308942	F047387	AGGAG	MAAQVAREILNDEEYADAEYQRFLKEKDKYVDFDEFCRKEEI