NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179956_1131723

Scaffold Ga0179956_1131723


Overview

Basic Information
Taxon OID3300019227 Open in IMG/M
Scaffold IDGa0179956_1131723 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)828
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan: Hyogo Prefecture
CoordinatesLat. (o)34.65Long. (o)135.05Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049736Metagenome / Metatranscriptome146Y
F052016Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0179956_11317232F052016AGGAMKLDRLPIMIPEGLRTIVRGIVCDPHGAGGRGRRKGAAMSDRISVVFSGTNKNFLYNCEIPISMLPRTGERIRLSIPGHSDIRCYVEDMEWQYAELEKRIDISIVARVKMLRED
Ga0179956_11317233F049736N/ARIREWLRNAKFAYWIIVWGLVFFAFVIVLGMAEIITTRQILLMGQAYFFLLMIGMLLQMIARRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.