Scaffold Ga0179957_1211925

Overview

Basic Information

• Taxon OID: 3300019222
• Scaffold ID: Ga0179957_1211925
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1417
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan: Hyogo Prefecture
• Coordinates
  • Lat. (^o): 34.65
  • Long. (^o): 135.05
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103319	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0179957_12119252	F103319	GGAGG	MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSLQYAANHNITDEHGTGTHDPVALTSQEHTYTGTFTYASFLVTGENVLTQKDVLTLTHLLQDQADEGVSKYFDIYIIEVQGKRTPGTGTTFEEQVEAALQNESMVGYIEALVDCKVTKVNRDIPEKNTVVSSREFKYSYKIPR