Scaffold Ga0179954_1065054

Overview

Basic Information

• Taxon OID: 3300019218
• Scaffold ID: Ga0179954_1065054
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNMR3_MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 832
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan: Gunma Prefecture
• Coordinates
  • Lat. (^o): 36.29
  • Long. (^o): 139.38
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030054	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0179954_10650541	F030054	N/A	NREKKLFFVVLVLLAVLLFNIESIKKKNKIINTNKELISSYKERINSSNLAIDSLQKAIEQAKKVDTVIKIRYKQKIDSIYVYKQGDYISFYDTLLHTNIQKSDTFICFDSISVQKLTIKLVNCSLDSELLANCLIQNNLYANIINIQDSVISLKDSINASLEDMYKQKVKKVKRQRNTFAGATFVEFLVILGLISK