NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180035_1043953

Scaffold Ga0180035_1043953


Overview

Basic Information
Taxon OID3300019191 Open in IMG/M
Scaffold IDGa0180035_1043953 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1173
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.217Long. (o)-123.78Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001222Metagenome / Metatranscriptome743Y
F003188Metagenome / Metatranscriptome502Y

Sequences

Protein IDFamilyRBSSequence
Ga0180035_10439531F003188GAGMIEPRKKVRQVLFSIHQLSYRIKEKSPSNEHMNKKIFIEVLEELKLIEERRDFMEEEIGMDMTQYEDQFFSVIENLFKLAFNKQQLGLIQLYLYQLVPDKEWDGTITIELGKEEKVVDFKTPENVWNTINLFTNG
Ga0180035_10439533F001222N/AMKQLEKLVKEVITEAAKINFAGHSFMLKVDTNEDPQKKGVKVQFIPTQFGQMTPTEQNDIAIELETRLEKGLGQFDMRVERDRNLKDKTIIGFFIYIEYFDRIIRKALAGENPDQGDAGAEPEQV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.