Scaffold Ga0194244_10121339

Overview

Basic Information

• Taxon OID: 3300019150
• Scaffold ID: Ga0194244_10121339
• Source Dataset Name: Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018614	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194244_101213391	F018614	AGGAG	MAEKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEDEISAALG