Scaffold Ga0194244_10104601

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194244_10104601

Scaffold Ga0194244_10104601

Overview

Basic Information
Taxon OID	3300019150 Open in IMG/M
Scaffold ID	Ga0194244_10104601 Open in IMG/M
Source Dataset Name	Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	538
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074919	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194244_101046012	F074919	N/A	EYADWNLGDKKPNWFHAMKAKKNMTVDHYSKWFLHLFVDADPDSPTYKQPVRFYGPYSGFAVYKSVKEGAPPAEVWDTVCVDNGWGTPEFKPFKHCDGKKLDTYKCMNVEKKNPEVCAPFENGAGAGEAEFIKGAFGNILLPKIEIAV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.