Scaffold Ga0193104_1045104

Overview

Basic Information

• Taxon OID: 3300019125
• Scaffold ID: Ga0193104_1045104
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 618
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Oxyrrhinales → Oxyrrhinaceae → Oxyrrhis → Oxyrrhis marina (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_152
• Coordinates
  • Lat. (^o): 43.6858
  • Long. (^o): -16.8474
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080096	Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193104_10451042	F080096	N/A	ADFGTEVEFEQVPFLMGSVSRPSCFDERSPCLEEQTAYCVIDIAQKADAGSKFPGQDKTVPWLICHGKGSSMETCHSQVGIDSSEVQSCLSDTSRIHGLMQQYLTRGKNVHGTPLEQVNGKTVGGDADYYAIKRAICNVDSSLSACSGLGDDVQV