Scaffold Ga0188839_1003647

Overview

Basic Information

• Taxon OID: 3300019122
• Scaffold ID: Ga0188839_1003647
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2205
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.581234
  • Long. (^o): 18.232801
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077332	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188839_10036473	F077332	N/A	MKRYTLRVNCVEVCRDIWSGDEMSEAIRLEAIAIKQWGKDNVWICDNLQEMMVG