Basic Information | |
---|---|
Taxon OID | 3300019095 Open in IMG/M |
Scaffold ID | Ga0188866_1009601 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dT |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 950 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 54.570232 | Long. (o) | 11.332183 | Alt. (m) | Depth (m) | .3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058163 | Metagenome / Metatranscriptome | 135 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188866_10096011 | F058163 | GGA | MLAYGEVSTTAANARPPYQSTLQIEEKNEPTWKLSSVLGHRDDQEVQNAYGEYSTLAANERPPYKSTVQLDSESESSDSESDDENNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG |
⦗Top⦘ |