Scaffold Ga0193455_10173258

Overview

Basic Information

• Taxon OID: 3300019052
• Scaffold ID: Ga0193455_10173258
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 959
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_132
• Coordinates
  • Lat. (^o): 31.5237
  • Long. (^o): -159.0351
  • Depth (m): 115

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048751	Metatranscriptome	147	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193455_101732582	F048751	AGGA	MQNLLIASVLAVASAEAFYGYQLPASGLGTWPSTSYGYGSSSTTYGAHGYRIGKRSADPSIGYGIGYGIAHVALPTTLENRNNVHGHELASGYAISQPHPGAAGSFQQRTQLHSGYGKRSADPSIGYGIAHVALPTTLENRNNVHGHELASQYAISQPHPGFGGSYQQVSRLHSGLHYGGYYGKRSAEPFYGGVAVHPGHAVSSTHRSAQGLSLGYGHGYGYGHGFYGYGKRSADAFYGAATSAYAVNQAHPGYAGSYQQVSRLHSGIGYGYGGYLY