Scaffold Ga0192857_10250829

Overview

Basic Information

• Taxon OID: 3300019040
• Scaffold ID: Ga0192857_10250829
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 589
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_065
• Coordinates
  • Lat. (^o): -35.1728
  • Long. (^o): 26.2868
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021236	Metatranscriptome	219	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192857_102508291	F021236	N/A	ADVTNTFINNIDLAIDPNPIEVVGGKTISLHFGVDVLKEVAAGATLELKLKKGILPIPCIDVGLPVPIGSCKYDIQQLLDFLAEDPDFDCDKYLPGNGCSLPMLPGHYGGEFHGEDAIVIELPQDLVIPDILKPFLDGKIKIHLSLAADGSEIVCADTEIGVTC