Scaffold Ga0193123_10407578

Overview

Basic Information

• Taxon OID: 3300019039
• Scaffold ID: Ga0193123_10407578
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 532
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Mediterranean Sea: TARA_011
• Coordinates
  • Lat. (^o): 41.6686
  • Long. (^o): 2.7996
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033053	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193123_104075781	F033053	GGA	MMTQSTTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGAIDVIKMPQFMRFLASDQYMSLGESG