Basic Information | |
---|---|
Taxon OID | 3300019031 Open in IMG/M |
Scaffold ID | Ga0193516_10152625 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 780 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico: TARA_142 | |||||||
Coordinates | Lat. (o) | 25.6168 | Long. (o) | -88.4532 | Alt. (m) | Depth (m) | 125 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047430 | Metagenome / Metatranscriptome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193516_101526251 | F047430 | N/A | REQHVVGGVGGKLIPRDVKGGFSRRKFETHFQTAPRRNIRNDFNGLSRTLGNGDERNLETTARNDFIVPVAEKDRPKKDLVRVDTFKHTKNPRPTDARQDGGMWSTHPRHPEDHGQRYFDTTTQTELDNGLRTRDDLVLPPVGEGQGEVCRGGHEKANTNFHVFPFGHAKNNFYCTPGNRSVFNRTSSMISRGAAPSPSGQSDDGEPKRFGRRYAFTGMARRAGARVFYDENVQ |
⦗Top⦘ |