Scaffold Ga0193535_10193478

Overview

Basic Information

• Taxon OID: 3300019024
• Scaffold ID: Ga0193535_10193478
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 649
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_152
• Coordinates
  • Lat. (^o): 43.7056
  • Long. (^o): -16.8794
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193535_101934781	F003454	N/A	RGYSSTMSLALLSFAFLGSVSAHGGVLWPPIWQAGVATPIEQLTSHEVFTEPKVVDPNSGRKVKSVKSWLTDQAYTGGVGDEFKGIGPVTNDNNKNLPEGDRCRKNCVKYRNPWAAPGQAPSLGGGCGVFGGNPWGCPAGKDDRPPGSNCGQDKPIGRGNRGTSSFGTDARLFDFPQMITTEWQVGSIQDVVWTSNGGHHGGYTYRLCKMPSGGR