Scaffold Ga0192951_10214587

Overview

Basic Information

• Taxon OID: 3300019022
• Scaffold ID: Ga0192951_10214587
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 710
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_082
• Coordinates
  • Lat. (^o): -47.2002
  • Long. (^o): -58.2034
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027855	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192951_102145871	F027855	N/A	REDSTVQKNYGDYSTLAADGRPPYKSTLQLDAESNADLSDSESDDDSNVALAADKVVEKNPIYNAWESVKDGAADGKYERVVTSHFASDADDIFMRSMITKYAHEKRTAIEELEDGTKIGGEPTGSFWLAKKDMFRAAKEVLGTHKGLAGAALSSYLDTYFDRAWSNFDVNADGAVEVLKAPQFMRFLASDQGMALGESG