Scaffold Ga0193078_10089255

Overview

Basic Information

• Taxon OID: 3300019004
• Scaffold ID: Ga0193078_10089255
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 697
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_051
• Coordinates
  • Lat. (^o): -21.4689
  • Long. (^o): 54.3066
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025753	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193078_100892551	F025753	N/A	PDRKSKSQNGGSKANSIAPSQGKPGGPQAGPYGYTEKGTYFEDSHFVGFPEKIEMVYQGFVWAMTVSYPDQNSLLHGGVHTILEDKVKRETLNLAGDYIVRVSGRASPYNINRLTFYTKKGKKYGPWGDRHSEDSVDFDVSAPPGQALAFFSGTIDFGVPLRSVSFHWRPISA