Scaffold Ga0193257_10186811

Overview

Basic Information

• Taxon OID: 3300018997
• Scaffold ID: Ga0193257_10186811
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Pacific Ocean: TARA_092
• Coordinates
  • Lat. (^o): -33.6771
  • Long. (^o): -71.9719
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010751	Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193257_101868112	F010751	GGAG	MVCPALASKRIEAVRRMVVAKQLAAANLPDPTCKTGVISLKETGKSQVCCAGYCGECSDYATCSSVRGQDSAFACCKSQVFERRCGNSPANVCLKSCTESLPPCIMDDEVVFTTPDPTLRTAGADCNTAIADWRLKAQDALTPASESDGQ