Basic Information | |
---|---|
Taxon OID | 3300018987 Open in IMG/M |
Scaffold ID | Ga0193188_10046219 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 726 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indian Ocean: TARA_038 | |||||||
Coordinates | Lat. (o) | 19.0235 | Long. (o) | 64.5256 | Alt. (m) | Depth (m) | 25 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040458 | Metatranscriptome | 161 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193188_100462191 | F040458 | N/A | FGLLLRLRHRKQHRKYITMLRLSLFIFAGLVLYVTATSGPLRDCDGFSASKCTPSPDVVLDGPFPFPTENDCQDACRDVADCEFYSYNGTEVNPECYYYTADYRQDCSVYAGTRDAKLDVCIRMVGFNHKCDEFLLNDCDYSGGILVEEARRGSIVDAYHCQDYCSIYESLGCDYWVFESADTAPLGTTCKLYTFNFSPSICKSHHGPSEPHYEDACGV |
⦗Top⦘ |