Scaffold Ga0193017_10139901

Overview

Basic Information

• Taxon OID: 3300018983
• Scaffold ID: Ga0193017_10139901
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 806
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_138
• Coordinates
  • Lat. (^o): 6.3559
  • Long. (^o): -103.0598
  • Depth (m): 450

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068418	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193017_101399012	F068418	AGGA	MDSWVWHEIGLELSDINVKGTIESEGGSKGGDNLGDESVQVSVGWSFDVKSSSADIVDSFIIKHDSNISMFKE