Basic Information | |
---|---|
Taxon OID | 3300018980 Open in IMG/M |
Scaffold ID | Ga0192961_10013424 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1878 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: TARA_083 | |||||||
Coordinates | Lat. (o) | -54.3739 | Long. (o) | -65.1342 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035480 | Metagenome / Metatranscriptome | 172 | Y |
F057667 | Metagenome / Metatranscriptome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0192961_100134241 | F057667 | N/A | MEIFVEHWQSILLALLIAARAIFSLVPTDTPAFKIFGWVDLIITALVGGDKRKKKRKKIIINK |
Ga0192961_100134243 | F035480 | GAG | MSLQITGAEKLYRNIDKVARWSIEDSQKLQDVGHRVGAVYANYIKANVKDLGKDTRLRGKLIKDGQLRRSGGTWLPNKKRNTVLAGPRTNAVGGRKVKNSANGFYAHIVEKGDFGPRFGGKHRTQNTGVFEKGIKATRSRSEKLQLMLLRQNFVQFTRGML |
⦗Top⦘ |