Basic Information | |
---|---|
Taxon OID | 3300018971 Open in IMG/M |
Scaffold ID | Ga0193559_10102988 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 934 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean: TARA_143 | |||||||
Coordinates | Lat. (o) | 29.8253 | Long. (o) | -79.6833 | Alt. (m) | Depth (m) | 40 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023516 | Metatranscriptome | 209 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193559_101029881 | F023516 | N/A | QSMFHLLLLFLVPLAAGHGGMLWPPSWQDGEGLPIPKITTYKVHSIPPMVDPESGRPIKHIKAWLTDQAYLGGHGDQFEGVGNVTNPECTKYKLWCPKKVPWASPGIAPSLGGGCGIFGGNPYGCPAGNDTREKGSACGQFKPKRGTFSFGSSALDMDFPQALTTTWPTGSKQDVAWVARGGHGGGYTYRLCKIPPQGKTGITEECFAQNILKFATPYTLMREVTGGNWTRVKQEDLTEGTFPPGSAWRHVAYTVYEGDGILRKDRVVVPDNLPEGDYVIGFRWDTHAPQIWVSCGNIEITKG |
⦗Top⦘ |